KCNJ9 anticorps (Middle Region)

N° du produit ABIN633729

Détail du produit anti-KCNJ9 anticorps

Antigène: KCNJ9 (Potassium Inwardly-Rectifying Channel, Subfamily J, Member 9 (KCNJ9))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCNJ9 est non-conjugé

Application: Western Blotting (WB)

Specificité: KCNJ9 antibody was raised against the middle region of KCNJ9

Purification: Affinity purified

Immunogène: KCNJ9 antibody was raised using the middle region of KCNJ9 corresponding to a region with amino acids CQARSSYLVDEVLWGHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSAR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KCNJ9 Blocking Peptide, catalog no. 33R-1778, is also available for use as a blocking control in assays to test for specificity of this KCNJ9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNJ9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KCNJ9

Antigène: KCNJ9 (Potassium Inwardly-Rectifying Channel, Subfamily J, Member 9 (KCNJ9))

Autre désignation: KCNJ9 (KCNJ9 Produits)

Synonymes: anticorps GIRK3, anticorps KIR3.3, anticorps 1700085N21Rik, anticorps Girk3, anticorps Kir3.3, anticorps mbGIRK3, anticorps potassium voltage-gated channel subfamily J member 9, anticorps potassium inwardly-rectifying channel, subfamily J, member 9, anticorps KCNJ9, anticorps Kcnj9

Sujet: Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel.

Poids moléculaire: 44 kDa (MW of target protein)