Kir2.2 anticorps (Middle Region)

N° du produit ABIN633733

Détail du produit anti-Kir2.2 anticorps

Antigène: Kir2.2 (KCNJ12) (Potassium Inwardly-Rectifying Channel, Subfamily J, Member 12 (KCNJ12))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Kir2.2 est non-conjugé

Application: Western Blotting (WB)

Specificité: KCNJ12 antibody was raised against the middle region of KCNJ12

Purification: Affinity purified

Immunogène: KCNJ12 antibody was raised using the middle region of KCNJ12 corresponding to a region with amino acids KDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQAR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KCNJ12 Blocking Peptide, catalog no. 33R-4295, is also available for use as a blocking control in assays to test for specificity of this KCNJ12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNJ12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Kir2.2

Antigène: Kir2.2 (KCNJ12) (Potassium Inwardly-Rectifying Channel, Subfamily J, Member 12 (KCNJ12))

Autre désignation: KCNJ12 (KCNJ12 Produits)

Synonymes: anticorps IRK-2, anticorps IRK2, anticorps KCNJN1, anticorps Kir2.2, anticorps Kir2.2v, anticorps hIRK, anticorps hIRK1, anticorps hkir2.2x, anticorps kcnj12x, anticorps Kir2.1, anticorps IRK, anticorps KIR2.2, anticorps MB-IRK2, anticorps potassium voltage-gated channel subfamily J member 12, anticorps ATP-sensitive inward rectifier potassium channel 12, anticorps potassium inwardly-rectifying channel, subfamily J, member 12, anticorps KCNJ12, anticorps LOC746628, anticorps Kcnj12

Sujet: KCNJ12 is an inwardly rectifying K+ channel which may be blocked by divalent cations. This protein is thought to be one of multiple inwardly rectifying channels which contribute to the cardiac inward rectifier current (IK1). This gene is located within the Smith-Magenis syndrome region on chromosome 17.

Poids moléculaire: 49 kDa (MW of target protein)