FXYD7 anticorps (N-Term)

N° du produit ABIN633734

Détail du produit anti-FXYD7 anticorps

Antigène: FXYD7 (FXYD Domain Containing Ion Transport Regulator 7 (FXYD7))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FXYD7 est non-conjugé

Application: Western Blotting (WB)

Specificité: FXYD7 antibody was raised against the N terminal of FXYD7

Purification: Affinity purified

Immunogène: FXYD7 antibody was raised using the N terminal of FXYD7 corresponding to a region with amino acids MATPTQTPTKAPEEPDPFYYDYNTVQTVGMTLATILFLLGILIVISKKVK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FXYD7 Blocking Peptide, catalog no. 33R-5788, is also available for use as a blocking control in assays to test for specificity of this FXYD7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FXYD7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FXYD7

Antigène: FXYD7 (FXYD Domain Containing Ion Transport Regulator 7 (FXYD7))

Autre désignation: FXYD7 (FXYD7 Produits)

Synonymes: anticorps 1110035I01Rik, anticorps FXYD domain containing ion transport regulator 7, anticorps FXYD domain-containing ion transport regulator 7, anticorps FXYD7, anticorps Fxyd7

Sujet: This reference sequence was derived from multiple replicate ESTs and validated by similar human genomic sequence. This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator.

Poids moléculaire: 8 kDa (MW of target protein)