CACNG6 anticorps (N-Term)
-
- Antigène Voir toutes CACNG6 Anticorps
- CACNG6 (Calcium Channel, Voltage-Dependent, gamma Subunit 6 (CACNG6))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CACNG6 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CACNG6 antibody was raised against the N terminal of CACNG6
- Purification
- Affinity purified
- Immunogène
- CACNG6 antibody was raised using the N terminal of CACNG6 corresponding to a region with amino acids MMWSNFFLQEENRRRGAAGRRRAHGQGRSGLTPEREGKVKLALLLAAVGA
- Top Product
- Discover our top product CACNG6 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CACNG6 Blocking Peptide, catalog no. 33R-6240, is also available for use as a blocking control in assays to test for specificity of this CACNG6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACNG6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CACNG6 (Calcium Channel, Voltage-Dependent, gamma Subunit 6 (CACNG6))
- Autre désignation
- CACNG6 (CACNG6 Produits)
- Synonymes
- anticorps CACNG6, anticorps cacng6, anticorps MGC122711, anticorps 2310033H20Rik, anticorps AW050150, anticorps calcium voltage-gated channel auxiliary subunit gamma 6, anticorps calcium channel, voltage-dependent, gamma subunit 6, anticorps CACNG6, anticorps cacng6, anticorps Cacng6
- Sujet
- CACNG6 is thought to stabilize the calcium channel in an inactivated (closed) state.
- Poids moléculaire
- 28 kDa (MW of target protein)
-