P2RX2 anticorps (N-Term)
-
- Antigène Voir toutes P2RX2 Anticorps
- P2RX2 (Purinergic Receptor P2X, Ligand Gated Ion Channel 2 (P2RX2))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp P2RX2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- P2 RX2 antibody was raised against the N terminal of P2 X2
- Purification
- Affinity purified
- Immunogène
- P2 RX2 antibody was raised using the N terminal of P2 X2 corresponding to a region with amino acids VVRNRRLGVLYRAVQLLILLYFVWYVFIVQKSYQESETGPESSIITKVKG
- Top Product
- Discover our top product P2RX2 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
P2RX2 Blocking Peptide, catalog no. 33R-9891, is also available for use as a blocking control in assays to test for specificity of this P2RX2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of P0 X2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- P2RX2 (Purinergic Receptor P2X, Ligand Gated Ion Channel 2 (P2RX2))
- Autre désignation
- P2RX2 (P2RX2 Produits)
- Synonymes
- anticorps DFNA41, anticorps P2X2, anticorps P2X2a, anticorps P2x2, anticorps p2xr2, anticorps P2RX2, anticorps purinergic receptor P2X 2, anticorps purinergic receptor P2X, ligand-gated ion channel, 2, anticorps P2RX2, anticorps P2rx2, anticorps p2rx2
- Sujet
- The product of P2RX2 belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle.
- Poids moléculaire
- 44 kDa (MW of target protein)
- Pathways
- Skeletal Muscle Fiber Development, Positive Regulation of Endopeptidase Activity
-