TRPC3 anticorps (N-Term)

N° du produit ABIN633752

Détail du produit anti-TRPC3 anticorps

Antigène: TRPC3 (Transient Receptor Potential Cation Channel, Subfamily C, Member 3 (TRPC3))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRPC3 est non-conjugé

Application: Western Blotting (WB)

Specificité: TRPC3 antibody was raised against the n terminal of TRPC3

Purification: Affinity purified

Immunogène: TRPC3 antibody was raised using the N terminal of TRPC3 corresponding to a region with amino acids MEGSPSLRRMTVMREKGRRQAVRGPAFMFNDRGTSLTAEEERFLDAAEYG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRPC3 Blocking Peptide, catalog no. 33R-5923, is also available for use as a blocking control in assays to test for specificity of this TRPC3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRPC3

Antigène: TRPC3 (Transient Receptor Potential Cation Channel, Subfamily C, Member 3 (TRPC3))

Autre désignation: TRPC3 (TRPC3 Produits)

Synonymes: anticorps TRPC3, anticorps Trpc3, anticorps TRP3, anticorps Mwk, anticorps Trcp3, anticorps Trp3, anticorps Trrp3, anticorps TrpC3c, anticorps transient receptor potential cation channel subfamily C member 3, anticorps transient receptor potential cation channel, subfamily C, member 3, anticorps TRPC3, anticorps Trpc3

Sujet: TRPC3 is thought to form a receptor-activated non-selective calcium permeant cation channel. Probably is operated by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases or G-protein coupled receptors. TRPC3 is activated by diacylglycerol (DAG) in a membrane-delimited fashion, independently of protein kinase C, and by inositol-1,4,5-triphosphate receptors (ITPR) with bound IP3. TRPC3 may also be activated by internal calcium store depletion.

Poids moléculaire: 97 kDa (MW of target protein)