KCNQ2 anticorps (N-Term)
-
- Antigène Voir toutes KCNQ2 Anticorps
- KCNQ2 (Potassium Voltage-Gated Channel, KQT-Like Subfamily, Member 2 (KCNQ2))
-
Épitope
- N-Term
-
Reactivité
- Rat, Humain, Souris, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KCNQ2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- KCNQ2 antibody was raised against the N terminal of KCNQ2
- Purification
- Affinity purified
- Immunogène
- KCNQ2 antibody was raised using the N terminal of KCNQ2 corresponding to a region with amino acids YRGWRGRLKFARKPFCVIDIMVLIASIAVLAAGSQGNVFATSALRSLRFL
- Top Product
- Discover our top product KCNQ2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KCNQ2 Blocking Peptide, catalog no. 33R-10224, is also available for use as a blocking control in assays to test for specificity of this KCNQ2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNQ2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KCNQ2 (Potassium Voltage-Gated Channel, KQT-Like Subfamily, Member 2 (KCNQ2))
- Autre désignation
- KCNQ2 (KCNQ2 Produits)
- Synonymes
- anticorps BFNC, anticorps BFNS1, anticorps EBN, anticorps EBN1, anticorps EIEE7, anticorps ENB1, anticorps HNSPC, anticorps KCNA11, anticorps KV7.2, anticorps KVEBN1, anticorps KQT2, anticorps Nmf134, anticorps mKQT2.3, anticorps mKQT2.4, anticorps zgc:171872, anticorps potassium voltage-gated channel subfamily Q member 2, anticorps potassium voltage-gated channel, subfamily Q, member 2, anticorps potassium voltage-gated channel subfamily KQT member 2, anticorps potassium voltage-gated channel, KQT-like subfamily, member 2a, anticorps KCNQ2, anticorps Kcnq2, anticorps LOC100537363, anticorps kcnq2a
- Sujet
- The M channel is a slowly activating and deactivating potassium channel that plays a critical role in the regulation of neuronal excitability. The M channel is formed by the association of the protein encoded by KCNQ2 and a related protein encoded by the KCNQ3 gene, both integral membrane proteins. M channel currents are inhibited by M1 muscarinic acetylcholine receptors and activated by retigabine, a novel anti-convulsant drug. Defects in KCNQ2 are a cause of benign familial neonatal convulsions type 1 (BFNC), also known as epilepsy, benign neonatal type 1 (EBN1).
- Poids moléculaire
- 93 kDa (MW of target protein)
-