GABRA5 anticorps

N° du produit ABIN633791

Détail du produit anti-GABRA5 anticorps

Antigène: GABRA5 (gamma-aminobutyric Acid (GABA) A Receptor, alpha 5 (GABRA5))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GABRA5 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: GABRA5 antibody was raised using a synthetic peptide corresponding to a region with amino acids AKIKKKREVILNKSTNAFTTGKMSHPPNIPKEQTPAGTSNTTSVSVKPSE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GABRA5 Blocking Peptide, catalog no. 33R-1296, is also available for use as a blocking control in assays to test for specificity of this GABRA5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABRA5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GABRA5

Antigène: GABRA5 (gamma-aminobutyric Acid (GABA) A Receptor, alpha 5 (GABRA5))

Autre désignation: GABRA5 (GABRA5 Produits)

Synonymes: anticorps GABRA5, anticorps si:dkey-93p24.1, anticorps A230018I05Rik, anticorps gamma-aminobutyric acid type A receptor alpha5 subunit, anticorps gamma-aminobutyric acid (GABA) A receptor, alpha 5, anticorps gamma-aminobutyric acid type A receptor alpha 5 subunit, anticorps gamma-aminobutyric acid (GABA) A receptor, subunit alpha 5, anticorps gamma-aminobutyric acid receptor subunit alpha-5, anticorps GABRA5, anticorps gabra5, anticorps Gabra5, anticorps LOC100653497

Sujet: GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. At least 16 distinct subunits of GABA-A receptors have been identified.

Poids moléculaire: 49 kDa (MW of target protein)

Pathways: Sensory Perception of Sound, Synaptic Membrane