DPYSL3 anticorps (Middle Region)

N° du produit ABIN633808

Détail du produit anti-DPYSL3 anticorps

Antigène: DPYSL3 (Dihydropyrimidinase-Like 3 (DPYSL3))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DPYSL3 est non-conjugé

Application: Western Blotting (WB)

Specificité: DPYSL3 antibody was raised against the middle region of DPYSL3

Purification: Affinity purified

Immunogène: DPYSL3 antibody was raised using the middle region of DPYSL3 corresponding to a region with amino acids VFDLTTTPKGGTPAGSARGSPTRPNPPVRNLHQSGFSLSGTQVDEGVRSA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DPYSL3 Blocking Peptide, catalog no. 33R-9522, is also available for use as a blocking control in assays to test for specificity of this DPYSL3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPYSL3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DPYSL3

Antigène: DPYSL3 (Dihydropyrimidinase-Like 3 (DPYSL3))

Autre désignation: DPYSL3 (DPYSL3 Produits)

Synonymes: anticorps CRMP4A, anticorps CRMP4B, anticorps dpysl3, anticorps DRP-3, anticorps MGC69487, anticorps dpysl3-b, anticorps crmp4, anticorps CRMP-4, anticorps xCRMP4, anticorps DRP-3-B, anticorps DPYSL3, anticorps CRMP4, anticorps DRP3, anticorps LCRMP, anticorps ULIP, anticorps ULIP-1, anticorps TUC4, anticorps Ulip, anticorps Ulip1, anticorps Crmp4, anticorps TUC-4b, anticorps drp-3, anticorps drp3, anticorps lcrmp, anticorps nsp1, anticorps tuc-4, anticorps tuc4, anticorps ulip, anticorps ulip-1, anticorps dihydropyrimidinase like 3, anticorps dihydropyrimidinase like 3 L homeolog, anticorps dihydropyrimidinase-like 3, anticorps dihydropyrimidinase like 3 S homeolog, anticorps DPYSL3, anticorps dpysl3, anticorps dpysl3.L, anticorps Dpysl3, anticorps dpysl3.S

Sujet: DPYSL3 is necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. DPYSL3 plays a role in axon guidance, neuronal growth cone collapse and cell migration.

Poids moléculaire: 62 kDa (MW of target protein)