TRAPPC4 anticorps (Middle Region)

N° du produit ABIN633833

Détail du produit anti-TRAPPC4 anticorps

Antigène: TRAPPC4 (Trafficking Protein Particle Complex 4 (TRAPPC4))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRAPPC4 est non-conjugé

Application: Western Blotting (WB)

Specificité: TRAPPC4 antibody was raised against the middle region of TRAPPC4

Purification: Affinity purified

Immunogène: TRAPPC4 antibody was raised using the middle region of TRAPPC4 corresponding to a region with amino acids EKLMLASMFHSLFAIGSQLSPEQGSSGIEMLETDTFKLHCYQTLTGIKFV

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRAPPC4 Blocking Peptide, catalog no. 33R-2512, is also available for use as a blocking control in assays to test for specificity of this TRAPPC4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRAPPC4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRAPPC4

Antigène: TRAPPC4 (Trafficking Protein Particle Complex 4 (TRAPPC4))

Autre désignation: TRAPPC4 (TRAPPC4 Produits)

Synonymes: anticorps HSPC172, anticorps PTD009, anticorps SBDN, anticorps SYNBINDIN, anticorps TRS23, anticorps 1500017G03Rik, anticorps AI303617, anticorps Sbd, anticorps Sbdn, anticorps Sdcbp2, anticorps zgc:73260, anticorps TRAPPC4, anticorps MGC131237, anticorps sbdn, anticorps trs23, anticorps ptd009, anticorps cgi-104, anticorps hspc172, anticorps trafficking protein particle complex 4, anticorps trafficking protein particle complex 4 S homeolog, anticorps TRAPPC4, anticorps Trappc4, anticorps trappc4, anticorps trappc4.S

Sujet: TRAPPC4 may play a role in vesicular transport from endoplasmic reticulum to Golgi.

Poids moléculaire: 24 kDa (MW of target protein)