CHERP anticorps (Middle Region)
-
- Antigène Voir toutes CHERP Anticorps
- CHERP (Calcium Homeostasis Endoplasmic Reticulum Protein (CHERP))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CHERP est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CHERP antibody was raised against the middle region of CHERP
- Purification
- Affinity purified
- Immunogène
- CHERP antibody was raised using the middle region of CHERP corresponding to a region with amino acids SERLLAAVEAFYSPPSHDRPRNSEGWEQNGLYEFFRAKMRARRRKGQEKR
- Top Product
- Discover our top product CHERP Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CHERP Blocking Peptide, catalog no. 33R-8400, is also available for use as a blocking control in assays to test for specificity of this CHERP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHERP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CHERP (Calcium Homeostasis Endoplasmic Reticulum Protein (CHERP))
- Autre désignation
- CHERP (CHERP Produits)
- Synonymes
- anticorps cherp, anticorps MGC53695, anticorps CHERP, anticorps DAN16, anticorps SCAF6, anticorps SRA1, anticorps ik:tdsubc_2h12, anticorps scaf6, anticorps wu:fc83d01, anticorps xx:tdsubc_2h12, anticorps zgc:55518, anticorps 5730408I11Rik, anticorps D8Wsu96e, anticorps Scaf6, anticorps calcium homeostasis endoplasmic reticulum protein S homeolog, anticorps calcium homeostasis endoplasmic reticulum protein, anticorps calcium homeostasis endoplasmic reticulum protein L homeolog, anticorps cherp.S, anticorps CHERP, anticorps cherp, anticorps Tsp_15667, anticorps cherp.L, anticorps Cherp
- Sujet
- CHERP is involved in calcium homeostasis, growth and proliferation.
- Poids moléculaire
- 104 kDa (MW of target protein)
-