APOE anticorps (N-Term)

N° du produit ABIN633837

Détail du produit anti-APOE anticorps

Antigène: APOE (Apolipoprotein E (APOE))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp APOE est non-conjugé

Application: Western Blotting (WB)

Specificité: ApoE antibody was raised against the N terminal of APOE

Purification: Affinity purified

Immunogène: ApoE antibody was raised using the N terminal of APOE corresponding to a region with amino acids KVLWAALLVTFLAGCQAKVEQAVETEPEPELRQQTEWQSGQRWELALGRF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ApoE Blocking Peptide, catalog no. 33R-4716, is also available for use as a blocking control in assays to test for specificity of this ApoE antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur APOE

Antigène: APOE (Apolipoprotein E (APOE))

Autre désignation: ApoE (APOE Produits)

Synonymes: anticorps ad2, anticorps apoprotein, anticorps im:7036787, anticorps wu:fb69a05, anticorps zgc:110064, anticorps apoe, anticorps AI255918, anticorps AD2, anticorps LDLCQ5, anticorps LPG, anticorps APOEA, anticorps Apo-E, anticorps apolipoprotein E, anticorps apolipoprotein Ea, anticorps apoe, anticorps apoea, anticorps Apoe, anticorps APOE

Sujet: Chylomicron remnants and very low density lipoprotein (VLDL) remnants are rapidly removed from the circulation by receptor-mediated endocytosis in the liver. Apolipoprotein E, a main apoprotein of the chylomicron, binds to a specific receptor on liver cells and peripheral cells. ApoE is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. Defects in apolipoprotein E result in familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides are the consequence of impaired clearance of chylomicron and VLDL remnants.

Poids moléculaire: 34 kDa (MW of target protein)

Pathways: Regulation of Cell Size, Lipid Metabolism