C21orf62 anticorps (Middle Region)

N° du produit ABIN633839

Détail du produit anti-C21orf62 anticorps

Antigène: C21orf62 (Chromosome 21 Open Reading Frame 62 (C21orf62))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C21orf62 est non-conjugé

Application: Western Blotting (WB)

Specificité: C21 ORF62 antibody was raised against the middle region of C21 rf62

Purification: Affinity purified

Immunogène: C21 ORF62 antibody was raised using the middle region of C21 rf62 corresponding to a region with amino acids STNTLPTEYLAICGLKRLRINMEAKHPFPEQSLLIHSGGDSDSREKPMWL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C21ORF62 Blocking Peptide, catalog no. 33R-8879, is also available for use as a blocking control in assays to test for specificity of this C21ORF62 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF62 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C21orf62

Antigène: C21orf62 (Chromosome 21 Open Reading Frame 62 (C21orf62))

Autre désignation: C21ORF62 (C21orf62 Produits)

Synonymes: anticorps B37, anticorps PRED81, anticorps C21orf120, anticorps MGC88933, anticorps chromosome 21 open reading frame 62, anticorps chromosome 1 open reading frame, human C21orf62, anticorps chromosome 3 open reading frame, human C21orf62, anticorps C21orf62, anticorps C1H21ORF62, anticorps c21orf62, anticorps C3H21orf62

Sujet: The function of C21orf62 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 28 kDa (MW of target protein)