MMP13 anticorps

N° du produit ABIN633868

Détail du produit anti-MMP13 anticorps

Antigène: MMP13 (Matrix Metallopeptidase 13 (Collagenase 3) (MMP13))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MMP13 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: MMP13 antibody was raised using a synthetic peptide corresponding to a region with amino acids HFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGET

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MMP13 Blocking Peptide, catalog no. 33R-3728, is also available for use as a blocking control in assays to test for specificity of this MMP13 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MMP13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MMP13

Antigène: MMP13 (Matrix Metallopeptidase 13 (Collagenase 3) (MMP13))

Autre désignation: MMP13 (MMP13 Produits)

Synonymes: anticorps CLG3, anticorps MANDP1, anticorps Clg, anticorps MMP-13, anticorps Mmp1, anticorps cb1034, anticorps mmp13, anticorps gene A, anticorps xCol, anticorps xcl3, anticorps MMP13, anticorps MGC108008, anticorps matrix metallopeptidase 13, anticorps matrix metallopeptidase 13a, anticorps matrix metallopeptidase 13 (collagenase 3) like S homeolog, anticorps matrix metallopeptidase 13 (collagenase 3), anticorps matrix metalloproteinase 13, anticorps matrix metallopeptidase 13 (collagenase 3) like L homeolog, anticorps MMP13, anticorps Mmp13, anticorps mmp13a, anticorps mmp13l.S, anticorps mmp13, anticorps LOC100136348, anticorps mmp13l.L

Sujet: Proteins of the matrix metalloproteinase (MMP) family are involved in the Breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes.

Poids moléculaire: 42 kDa (MW of target protein)