CYP2C19 anticorps (Middle Region)

N° du produit ABIN633899

Détail du produit anti-CYP2C19 anticorps

Antigène: CYP2C19 (Cytochrome P450, Family 2, Subfamily C, Polypeptide 19 (CYP2C19))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CYP2C19 est non-conjugé

Application: Western Blotting (WB)

Specificité: CYP2 C19 antibody was raised against the middle region of CYP2 19

Purification: Affinity purified

Immunogène: CYP2 C19 antibody was raised using the middle region of CYP2 19 corresponding to a region with amino acids QEEIERVIGRNRSPCMQDRGHMPYTDAVVHEVQRYIDLIPTSLPHAVTCD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CYP2C19 Blocking Peptide, catalog no. 33R-7517, is also available for use as a blocking control in assays to test for specificity of this CYP2C19 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 19 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CYP2C19

Antigène: CYP2C19 (Cytochrome P450, Family 2, Subfamily C, Polypeptide 19 (CYP2C19))

Autre désignation: CYP2C19 (CYP2C19 Produits)

Synonymes: anticorps CPCJ, anticorps CYP2C, anticorps P450C2C, anticorps P450IIC19, anticorps cytochrome P450 family 2 subfamily C member 19, anticorps cytochrome P450, family 2, subfamily C, polypeptide 19, anticorps cytochrome P450 2C19, anticorps CYP2C19

Sujet: CYP2C19 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize many xenobiotics, including the anticonvulsive drug mephenytoin, omeprazole, diazepam and some barbiturates. Polymorphism within this gene is associated with variable ability to metabolize mephenytoin, known as the poor metabolizer and extensive metabolizer phenotypes.

Poids moléculaire: 56 kDa (MW of target protein)