QPCT anticorps

N° du produit ABIN633915

Détail du produit anti-QPCT anticorps

Antigène: QPCT (Glutaminyl-Peptide Cyclotransferase (QPCT))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp QPCT est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: QPCT antibody was raised using a synthetic peptide corresponding to a region with amino acids SRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

QPCT Blocking Peptide, catalog no. 33R-8755, is also available for use as a blocking control in assays to test for specificity of this QPCT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of QPCT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur QPCT

Antigène: QPCT (Glutaminyl-Peptide Cyclotransferase (QPCT))

Autre désignation: QPCT (QPCT Produits)

Synonymes: anticorps GCT, anticorps QC, anticorps sQC, anticorps QPCT, anticorps 5730422A13Rik, anticorps Qpctl1, anticorps RGD1562284, anticorps qpct, anticorps glutaminyl-peptide cyclotransferase, anticorps glutaminyl-peptide cyclotransferase (glutaminyl cyclase), anticorps glutaminyl-peptide cyclotransferase L homeolog, anticorps QPCT, anticorps Qpct, anticorps M6_Spy0443, anticorps M5005_Spy_0416, anticorps M28_Spy0404, anticorps CJA_2408, anticorps CCNA_02733, anticorps Tsp_03182, anticorps qpct.L

Sujet: QPCT is responsible for the biosynthesis of pyroglutamyl peptides. QPCT has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue. It also catalyzes N-terminal pyroglutamate formation. In vitro, catalyzes pyroglutamate formation of N-terminally truncated form of APP amyloid-beta peptides [Glu-3]-beta-amyloid.

Poids moléculaire: 38 kDa (MW of target protein)