FBLN3 anticorps (Middle Region)
-
- Antigène Voir toutes FBLN3 Anticorps
- FBLN3 (Fibulin 3 (FBLN3))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FBLN3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- EFEMP1 antibody was raised against the middle region of EFEMP1
- Purification
- Affinity purified
- Immunogène
- EFEMP1 antibody was raised using the middle region of EFEMP1 corresponding to a region with amino acids GNENGEFYLRQTSPVSAMLVLVKSLSGPREHIVDLEMLTVSSIGTFRTSS
- Top Product
- Discover our top product FBLN3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
EFEMP1 Blocking Peptide, catalog no. 33R-3444, is also available for use as a blocking control in assays to test for specificity of this EFEMP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EFEMP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FBLN3 (Fibulin 3 (FBLN3))
- Autre désignation
- EFEMP1 (FBLN3 Produits)
- Synonymes
- anticorps DHRD, anticorps DRAD, anticorps FBLN3, anticorps FBNL, anticorps FIBL-3, anticorps MLVT, anticorps MTLV, anticorps S1-5, anticorps T16, anticorps EGF containing fibulin like extracellular matrix protein 1, anticorps EGF-containing fibulin-like extracellular matrix protein 1, anticorps epidermal growth factor-containing fibulin-like extracellular matrix protein 1, anticorps EFEMP1, anticorps Efemp1
- Sujet
- EFEMP1 genepans approximately 18 kb of genomic DNA and consists of 12 exons. Alternative splice patterns in the 5' UTR result in three transcript variants encoding the same extracellular matrix protein. Mutations in this gene are associated with Doyne honeycomb retinal dystrophy.
- Poids moléculaire
- 53 kDa (MW of target protein)
- Pathways
- EGFR Signaling Pathway
-