MATN1 anticorps (Middle Region)
-
- Antigène Voir toutes MATN1 Anticorps
- MATN1 (Matrilin 1, Cartilage Matrix Protein (MATN1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MATN1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Matrilin 1 antibody was raised against the middle region of MATN1
- Purification
- Affinity purified
- Immunogène
- Matrilin 1 antibody was raised using the middle region of MATN1 corresponding to a region with amino acids KYLIDNSFTVSSGARPGAQKVGIVFTDGRSQDYINDAAKKAKDLGFKMFA
- Top Product
- Discover our top product MATN1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Matrilin 1 Blocking Peptide, catalog no. 33R-4743, is also available for use as a blocking control in assays to test for specificity of this Matrilin 1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MATN1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MATN1 (Matrilin 1, Cartilage Matrix Protein (MATN1))
- Autre désignation
- Matrilin 1 (MATN1 Produits)
- Synonymes
- anticorps cmp, anticorps crtm, anticorps xmatn1, anticorps MGC64509, anticorps MGC108367, anticorps CMP, anticorps CRTM, anticorps Crtm, anticorps Mat1, anticorps matrilin-1, anticorps matrilin 1, cartilage matrix protein L homeolog, anticorps matrilin 1, anticorps matrilin 1, cartilage matrix protein, anticorps matn1.L, anticorps matn1, anticorps MATN1, anticorps Matn1
- Sujet
- This gene encodes a member of von Willebrand factor A domain containing protein family. This family of proteins are thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues.
- Poids moléculaire
- 54 kDa (MW of target protein)
-