MATN1 anticorps (Middle Region)

N° du produit ABIN633926

L’anticorps anti-MATN1 Polyclonal Lapin est utilisé pour la détection de MATN1 dans des échantillons de Humain, Souris et Rat. Il a été validé pour WB.

Aperçu rapide pour MATN1 anticorps (Middle Region) (ABIN633926)

Antigène: MATN1 (Matrilin 1, Cartilage Matrix Protein (MATN1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MATN1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MATN1 anticorps

Épitope: Middle Region

Specificité: Matrilin 1 antibody was raised against the middle region of MATN1

Purification: Affinity purified

Immunogène: Matrilin 1 antibody was raised using the middle region of MATN1 corresponding to a region with amino acids KYLIDNSFTVSSGARPGAQKVGIVFTDGRSQDYINDAAKKAKDLGFKMFA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Matrilin 1 Blocking Peptide, (ABIN940129), is also available for use as a blocking control in assays to test for specificity of this Matrilin 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MATN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MATN1

Antigène: MATN1 (Matrilin 1, Cartilage Matrix Protein (MATN1))

Autre désignation: Matrilin 1

Sujet: This gene encodes a member of von Willebrand factor A domain containing protein family. This family of proteins are thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues.

Poids moléculaire: 54 kDa (MW of target protein)