CPB2 anticorps

N° du produit ABIN633937

Détail du produit anti-CPB2 anticorps

Antigène: CPB2 (Carboxypeptidase B2 (Plasma) (CPB2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CPB2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: Carboxypeptidase B2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSKSKDHEELSLVASEAVRAIEKTSKNTRYTHGHGSETLYLAPGGGDDWI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Carboxypeptidase B2 Blocking Peptide, catalog no. 33R-8190, is also available for use as a blocking control in assays to test for specificity of this Carboxypeptidase B2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPB2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CPB2

Antigène: CPB2 (Carboxypeptidase B2 (Plasma) (CPB2))

Autre désignation: Carboxypeptidase B2 (CPB2 Produits)

Synonymes: anticorps CPU, anticorps PCPB, anticorps TAFI, anticorps 1110032P04Rik, anticorps 4930405E17Rik, anticorps AI255929, anticorps CPR, anticorps Cpu, anticorps pCPB, anticorps zgc:112493, anticorps carboxypeptidase B2, anticorps carboxypeptidase B2 (plasma), anticorps CPB2, anticorps Cpb2, anticorps cpb2

Sujet: Carboxypeptidases are enzymes that hydrolyze C-terminal peptide bonds. The carboxypeptidase family includes metallo-, serine, and cysteine carboxypeptidases. According to their substrate specificity, these enzymes are referred to as carboxypeptidase A (cleaving aliphatic residues) or carboxypeptidase B (cleaving basic amino residues). CPB2 is activated by trypsin and acts on carboxypeptidase B substrates. After thrombin activation, the mature protein downregulates fibrinolysis.

Poids moléculaire: 36 kDa (MW of target protein)

Pathways: Regulation of Actin Filament Polymerization, Carbohydrate Homeostasis