WNT2 anticorps (Middle Region)

N° du produit ABIN633953

Détail du produit anti-WNT2 anticorps

Antigène: WNT2 (Wingless-Type MMTV Integration Site Family Member 2 (WNT2))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp WNT2 est non-conjugé

Application: Western Blotting (WB)

Specificité: WNT2 antibody was raised against the middle region of WNT2

Purification: Affinity purified

Immunogène: WNT2 antibody was raised using the middle region of WNT2 corresponding to a region with amino acids GSAKDSKGIFDWGGCSDNIDYGIKFARAFVDAKERKGKDARALMNLHNNR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WNT2 Blocking Peptide, catalog no. 33R-3548, is also available for use as a blocking control in assays to test for specificity of this WNT2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur WNT2

Antigène: WNT2 (Wingless-Type MMTV Integration Site Family Member 2 (WNT2))

Autre désignation: WNT2 (WNT2 Produits)

Synonymes: anticorps CG1916, anticorps D-wnt-2, anticorps DWnt-2, anticorps DWnt2, anticorps Dm DWnt2, anticorps Dm-2, anticorps Dmel\\CG1916, anticorps Dwnt-2, anticorps Wnt, anticorps Wnt-2, anticorps dWnt2, anticorps wnt2, anticorps WNT2, anticorps irp, anticorps Xwnt2, anticorps wnt-2, anticorps Xwnt-2, anticorps int1l1, anticorps 2610510E18Rik, anticorps Int1l1, anticorps Irp, anticorps Mirp, anticorps Wnt2a, anticorps INT1L1, anticorps IRP, anticorps ZfWnt2, anticorps Wnt oncogene analog 2, anticorps Wnt family member 2, anticorps wingless-type MMTV integration site family member 2, anticorps wingless-type MMTV integration site family, member 2, anticorps Wnt2, anticorps wnt2, anticorps WNT2

Sujet: WNT2 is the ligand for members of the frizzled family of seven transmembrane receptors. WNT2 is a probable developmental protein. WNT2 may be a signaling molecule which affects the development of discrete regions of tissues. WNT2 is likely to signal over only few cell diameters.

Poids moléculaire: 38 kDa (MW of target protein)

Pathways: Signalisation WNT