TFPI2 anticorps (Middle Region)
-
- Antigène Voir toutes TFPI2 Anticorps
- TFPI2 (Tissue Factor Pathway Inhibitor 2 (TFPI2))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TFPI2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TFPI2 antibody was raised against the middle region of TFPI2
- Purification
- Affinity purified
- Immunogène
- TFPI2 antibody was raised using the middle region of TFPI2 corresponding to a region with amino acids NANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMT
- Top Product
- Discover our top product TFPI2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TFPI2 Blocking Peptide, catalog no. 33R-6642, is also available for use as a blocking control in assays to test for specificity of this TFPI2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TFPI2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TFPI2 (Tissue Factor Pathway Inhibitor 2 (TFPI2))
- Autre désignation
- TFPI2 (TFPI2 Produits)
- Synonymes
- anticorps MGC68843, anticorps TFPI2, anticorps MGC108301, anticorps si:ch211-262k23.2, anticorps tfpi2, anticorps PP5, anticorps REF1, anticorps TFPI-2, anticorps AV000670, anticorps PP5/TFPI-2, anticorps tissue factor pathway inhibitor 2 L homeolog, anticorps tissue factor pathway inhibitor 2, anticorps tfpi2.L, anticorps TFPI2, anticorps tfpi2, anticorps Tfpi2
- Sujet
- TFPI2 may play a role in the regulation of plasmin-mediated matrix remodeling. It inhibits trypsin, plasmin, factor VIIa/tissue factor and weakly factor Xa. TFPI2 has no effect on thrombin.
- Poids moléculaire
- 26 kDa (MW of target protein)
-