TFPI2 anticorps (Middle Region)

N° du produit ABIN633956

Détail du produit anti-TFPI2 anticorps

Antigène: TFPI2 (Tissue Factor Pathway Inhibitor 2 (TFPI2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TFPI2 est non-conjugé

Application: Western Blotting (WB)

Specificité: TFPI2 antibody was raised against the middle region of TFPI2

Purification: Affinity purified

Immunogène: TFPI2 antibody was raised using the middle region of TFPI2 corresponding to a region with amino acids NANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TFPI2 Blocking Peptide, catalog no. 33R-6642, is also available for use as a blocking control in assays to test for specificity of this TFPI2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TFPI2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TFPI2

Antigène: TFPI2 (Tissue Factor Pathway Inhibitor 2 (TFPI2))

Autre désignation: TFPI2 (TFPI2 Produits)

Synonymes: anticorps MGC68843, anticorps TFPI2, anticorps MGC108301, anticorps si:ch211-262k23.2, anticorps tfpi2, anticorps PP5, anticorps REF1, anticorps TFPI-2, anticorps AV000670, anticorps PP5/TFPI-2, anticorps tissue factor pathway inhibitor 2 L homeolog, anticorps tissue factor pathway inhibitor 2, anticorps tfpi2.L, anticorps TFPI2, anticorps tfpi2, anticorps Tfpi2

Sujet: TFPI2 may play a role in the regulation of plasmin-mediated matrix remodeling. It inhibits trypsin, plasmin, factor VIIa/tissue factor and weakly factor Xa. TFPI2 has no effect on thrombin.

Poids moléculaire: 26 kDa (MW of target protein)