PLG anticorps (Middle Region)

N° du produit ABIN633957

Cet anticorps anti-PLG est un anticorps Lapin Polyclonal détectant PLG dans WB. Adapté pour Humain. Ce Primary Antibody a été cité dans 2+ publications.

Aperçu rapide pour PLG anticorps (Middle Region) (ABIN633957)

Antigène: PLG (Plasminogen (PLG))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PLG est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PLG anticorps

Épitope: Middle Region

Specificité: Plasminogen antibody was raised against the middle region of PLG

Purification: Affinity purified

Immunogène: Plasminogen antibody was raised using the middle region of PLG corresponding to a region with amino acids LISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Plasminogen Blocking Peptide, (ABIN940452), is also available for use as a blocking control in assays to test for specificity of this Plasminogen antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Références pour anticorps anti-PLG (ABIN633957)

Giraud, Chabaud, Lejeune, Barbaria, Mallet: "The plasminogen-like molecule apically secreted by epithelial thyroid cells is sulfated." dans: Biochemical and biophysical research communications, Vol. 346, Issue 3, pp. 746-50, (2006) (PubMed).

Giraud, Dicristofaro, De Micco, Lejeune, Barbaria, Mallet: "A plasminogen-like protein, present in the apical extracellular environment of thyroid epithelial cells, degrades thyroglobulin in vitro." dans: Biochemical and biophysical research communications, Vol. 338, Issue 2, pp. 1000-4, (2005) (PubMed).

Détails sur PLG

Antigène: PLG (Plasminogen (PLG))

Autre désignation: Plasminogen

Sujet: The protein encoded by this gene is a secreted blood zymogen that is activated by proteolysis and converted to plasmin and angiostatin.

Poids moléculaire: 88 kDa (MW of target protein)

Pathways: Système du Complément, Lipid Metabolism