ENPP6 anticorps (Middle Region)

N° du produit ABIN633965

Détail du produit anti-ENPP6 anticorps

Antigène: ENPP6 (Ectonucleotide pyrophosphatase/phosphodiesterase 6 (ENPP6))

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ENPP6 est non-conjugé

Application: Western Blotting (WB)

Specificité: ENPP6 antibody was raised against the middle region of ENPP6

Purification: Affinity purified

Immunogène: ENPP6 antibody was raised using the middle region of ENPP6 corresponding to a region with amino acids ELMDMRGIFLAFGPDFKSNFRAAPIRSVDVYNVMCNVVGITPLPNNGSWS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ENPP6 Blocking Peptide, catalog no. 33R-2561, is also available for use as a blocking control in assays to test for specificity of this ENPP6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ENPP6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ENPP6

Antigène: ENPP6 (Ectonucleotide pyrophosphatase/phosphodiesterase 6 (ENPP6))

Autre désignation: ENPP6 (ENPP6 Produits)

Synonymes: anticorps E-NPP 6, anticorps cb1028, anticorps sb:cb727, anticorps zgc:103605, anticorps NPP6, anticorps NPP-6, anticorps 4833421B01Rik, anticorps B830047L21Rik, anticorps D8Ertd514e, anticorps Npp6, anticorps E-NPP6, anticorps ectonucleotide pyrophosphatase/phosphodiesterase 6, anticorps ectonucleotide pyrophosphatase/phosphodiesterase 6 L homeolog, anticorps enpp6, anticorps enpp6.L, anticorps ENPP6, anticorps Enpp6

Sujet: ENPP6 is a choline-specific glycerophosphodiester phosphodiesterase. ENPP6 hydrolyzes the classical substrate for phospholipase C, p-nitrophenyl phosphorylcholine, while it does not hydrolyze the classical nucleotide phosphodiesterase substrate, p-nitrophenyl thymidine 5'-monophosphate.

Poids moléculaire: 50 kDa (MW of target protein)