Elastase 4 anticorps

N° du produit ABIN634038

Détail du produit anti-Elastase 4 anticorps

Antigène: Elastase 4 (CTRC) (Chymotrypsin C (Caldecrin) (CTRC))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Elastase 4 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: Chymotrypsin C antibody was raised using a synthetic peptide corresponding to a region with amino acids LGITVLAALLACASSCGVPSFPPNLSARVVGGEDARPHSWPWQISLQYLK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Chymotrypsin C Blocking Peptide, catalog no. 33R-4977, is also available for use as a blocking control in assays to test for specificity of this Chymotrypsin C antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CTRC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Elastase 4

Antigène: Elastase 4 (CTRC) (Chymotrypsin C (Caldecrin) (CTRC))

Autre désignation: Chymotrypsin C (CTRC Produits)

Synonymes: anticorps CLCR, anticorps ELA4, anticorps 1810044E12Rik, anticorps bPTLP, anticorps chymotrypsin C, anticorps chymotrypsin-C, anticorps chymotrypsin C (caldecrin), anticorps CTRC, anticorps LOC478220, anticorps Ctrc

Sujet: CTRC is a member of the peptidase S1 family. The protein is a serum calcium-decreasing factor that has chymotrypsin-like protease activity. Alternatively spliced transcript variants have been observed, but their full-length nature has not been determined. This gene encodes a member of the peptidase S1 family. The encoded protein is a serum calcium-decreasing factor that has chymotrypsin-like protease activity. Alternatively spliced transcript variants have been observed, but their full-length nature has not been determined.

Poids moléculaire: 27 kDa (MW of target protein)