CTRP7 anticorps (Middle Region)

N° du produit ABIN634045

Détail du produit anti-CTRP7 anticorps

Antigène: CTRP7 (C1QTNF7) (C1q and Tumor Necrosis Factor Related Protein 7 (C1QTNF7))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CTRP7 est non-conjugé

Application: Western Blotting (WB)

Specificité: C1 QTNF7 antibody was raised against the middle region of C1 TNF7

Purification: Affinity purified

Immunogène: C1 QTNF7 antibody was raised using the middle region of C1 TNF7 corresponding to a region with amino acids SIVLKSAFSVGITTSYPEERLPIIFNKVLFNEGEHYNPATGKFICAFPGI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C1QTNF7 Blocking Peptide, catalog no. 33R-8542, is also available for use as a blocking control in assays to test for specificity of this C1QTNF7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 TNF7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CTRP7

Antigène: CTRP7 (C1QTNF7) (C1q and Tumor Necrosis Factor Related Protein 7 (C1QTNF7))

Autre désignation: C1QTNF7 (C1QTNF7 Produits)

Synonymes: anticorps C1QTNF7, anticorps 5530401N20Rik, anticorps 8430425G24Rik, anticorps Ctrp7, anticorps CTRP7, anticorps ZACRP7, anticorps C1q and tumor necrosis factor related protein 7, anticorps C1q and TNF related 7, anticorps C1QTNF7, anticorps C1qtnf7

Sujet: The specific function of C1QTNF7 is not yet known.

Poids moléculaire: 31 kDa (MW of target protein)