STAG3 anticorps (Middle Region)

N° du produit ABIN634086

Détail du produit anti-STAG3 anticorps

Antigène: STAG3 (Stromal Antigen 3 (STAG3))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp STAG3 est non-conjugé

Application: Western Blotting (WB)

Specificité: STAG3 antibody was raised against the middle region of STAG3

Purification: Affinity purified

Immunogène: STAG3 antibody was raised using the middle region of STAG3 corresponding to a region with amino acids VPHQVILPALTLVYFSILWTLTHISKSDASQKQLSSLRDRMVAFCELCQS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

STAG3 Blocking Peptide, catalog no. 33R-9729, is also available for use as a blocking control in assays to test for specificity of this STAG3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STAG3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur STAG3

Antigène: STAG3 (Stromal Antigen 3 (STAG3))

Autre désignation: STAG3 (STAG3 Produits)

Synonymes: anticorps STAG3, anticorps SA-2, anticorps stromal antigen 3, anticorps STAG3, anticorps stag3, anticorps Stag3

Sujet: STAG3 is a meiosis specific component of cohesin complex. The cohesin complex is required for the cohesion of sister chromatids after DNA replication. The cohesin complex apparently forms a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. The meiosis-specific cohesin complex probably replaces mitosis specific cohesin complex when it dissociates from chromatin during prophase I.

Poids moléculaire: 135 kDa (MW of target protein)