CENPB anticorps (C-Term)

N° du produit ABIN634099

Détail du produit anti-CENPB anticorps

Antigène: CENPB (Centromere Protein B (CENPB))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CENPB est non-conjugé

Application: Western Blotting (WB)

Specificité: CENPB antibody was raised against the C terminal of CENPB

Purification: Affinity purified

Immunogène: CENPB antibody was raised using the C terminal of CENPB corresponding to a region with amino acids GGEDSDSDSEEEDDEEEDDEDEDDDDDEEDGDEVPVPSFGEAMAYFAMVK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CENPB Blocking Peptide, catalog no. 33R-3277, is also available for use as a blocking control in assays to test for specificity of this CENPB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CENPB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CENPB

Antigène: CENPB (Centromere Protein B (CENPB))

Autre désignation: CENPB (CENPB Produits)

Synonymes: anticorps CENPB, anticorps CENP-B, anticorps centromere protein B, anticorps centromere protein B, 80kDa, anticorps CENPB, anticorps Cenpb

Sujet: CENPB is a highly conserved protein that facilitates centromere formation. It is a DNA-binding protein that is derived from transposases of the pogo DNA transposon family. It contains a helix-loop-helix DNA binding motif at the N-terminus, and a dimerization domain at the C-terminus. This protein is proposed to play an important role in the assembly of specific centromere structures in interphase nuclei and on mitotic chromosomes. It is also considered a major centromere autoantigen recognised by sera from patients with anti-centromere antibodies.

Poids moléculaire: 65 kDa (MW of target protein)