HECA anticorps

N° du produit ABIN634109

Détail du produit anti-HECA anticorps

Antigène: HECA (Headcase Homolog (HECA))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HECA est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: HECA antibody was raised using a synthetic peptide corresponding to a region with amino acids HKLNTFHVRMEDDAQVGQGEDLRKFILAALSASHRNVVNCALCHRALPVF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HECA Blocking Peptide, catalog no. 33R-3766, is also available for use as a blocking control in assays to test for specificity of this HECA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HECA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HECA

Antigène: HECA (Headcase Homolog (HECA))

Autre désignation: HECA (HECA Produits)

Synonymes: anticorps HECA, anticorps si:dkey-34f16.2, anticorps HDC, anticorps HDCL, anticorps HHDC, anticorps dJ225E12.1, anticorps Gm869, anticorps hdc homolog, cell cycle regulator, anticorps Heca, anticorps HECA, anticorps heca

Sujet: This gene encodes the homolog of the Drosophila headcase protein, a highly basic, cytoplasmic protein that regulates the re-entry of imaginal cells into the mitotic cycle during adult morphogenesis.

Poids moléculaire: 59 kDa (MW of target protein)