HECA anticorps

N° du produit ABIN634109

L’anticorps anti-HECA Polyclonal Lapin est utilisé pour la détection de HECA dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour HECA anticorps (ABIN634109)

Antigène: HECA (Headcase Homolog (HECA))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HECA est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-HECA anticorps

Purification: Affinity purified

Immunogène: HECA antibody was raised using a synthetic peptide corresponding to a region with amino acids HKLNTFHVRMEDDAQVGQGEDLRKFILAALSASHRNVVNCALCHRALPVF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HECA Blocking Peptide, (ABIN939152), is also available for use as a blocking control in assays to test for specificity of this HECA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HECA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HECA

Antigène: HECA (Headcase Homolog (HECA))

Autre désignation: HECA

Sujet: This gene encodes the homolog of the Drosophila headcase protein, a highly basic, cytoplasmic protein that regulates the re-entry of imaginal cells into the mitotic cycle during adult morphogenesis.

Poids moléculaire: 59 kDa (MW of target protein)