CDC45 anticorps

N° du produit ABIN634130

Détail du produit anti-CDC45 anticorps

Antigène: CDC45 (Cell Division Cycle 45 Homolog (S. Cerevisiae) (CDC45))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CDC45 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: CDC45 L antibody was raised using a synthetic peptide corresponding to a region with amino acids VTVVGIPPETDSSDRKNFFGRAFEKAAESTSSRMLHNHFDLSVIELKAED

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CDC45L Blocking Peptide, catalog no. 33R-9861, is also available for use as a blocking control in assays to test for specificity of this CDC45L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDC40 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CDC45

Antigène: CDC45 (Cell Division Cycle 45 Homolog (S. Cerevisiae) (CDC45))

Autre désignation: CDC45L (CDC45 Produits)

Synonymes: anticorps cdc45l, anticorps cdc45l2, anticorps porc-pi-1, anticorps CDC45L, anticorps CDC45L2, anticorps PORC-PI-1, anticorps Cdc45l, anticorps cell division cycle 45, anticorps cell division cycle 45 S homeolog, anticorps cell division cycle 45 L homeolog, anticorps cdc45, anticorps CDC45, anticorps cdc45.S, anticorps Cdc45, anticorps cdc45.L

Sujet: CDC45L was identified by its strong similarity with Saccharomyces cerevisiae Cdc45, an essential protein required to the initiation of DNA replication. Cdc45 is a member of the highly conserved multiprotein complex including Cdc6/Cdc18, the minichromosome maintenance proteins (MCMs) and DNA polymerase, which is important for early steps of DNA replication in eukaryotes.

Poids moléculaire: 65 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA