KIF23 anticorps (Middle Region)
-
- Antigène Voir toutes KIF23 Anticorps
- KIF23 (Kinesin Family Member 23 (KIF23))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KIF23 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- KIF23 antibody was raised against the middle region of KIF23
- Purification
- Affinity purified
- Immunogène
- KIF23 antibody was raised using the middle region of KIF23 corresponding to a region with amino acids KDEKLKQLKAIVTEPKTEKPERPSRERDREKVTQRSVSPSPVPLLFQPDQ
- Top Product
- Discover our top product KIF23 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KIF23 Blocking Peptide, catalog no. 33R-4282, is also available for use as a blocking control in assays to test for specificity of this KIF23 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF23 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KIF23 (Kinesin Family Member 23 (KIF23))
- Autre désignation
- KIF23 (KIF23 Produits)
- Synonymes
- anticorps KIF23, anticorps CHO1, anticorps KNSL5, anticorps MKLP-1, anticorps MKLP1, anticorps 3110001D19Rik, anticorps C87313, anticorps Knsl5, anticorps cb738, anticorps knsl5, anticorps mklp1, anticorps wu:fi30e02, anticorps wu:fi39f08, anticorps zMKLP1, anticorps cho1, anticorps mklp-1, anticorps kinesin family member 23, anticorps kinesin family member 23 S homeolog, anticorps KIF23, anticorps kif23, anticorps Kif23, anticorps kif23.S
- Sujet
- KIF23 is a member of kinesin-like protein family. This family includes microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. This protein has been shown to cross-bridge antiparallel microtubules and drive microtubule movement in vitro. Alternate splicing of this gene results in two transcript variants encoding two different isoforms.
- Poids moléculaire
- 98 kDa (MW of target protein)
-