PPP2R3B anticorps

N° du produit ABIN634157

Détail du produit anti-PPP2R3B anticorps

Antigène: PPP2R3B (Protein Phosphatase 2A 48 KDa Regulatory Subunit (PPP2R3B))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PPP2R3B est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PPP2 R2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PPP2R3B Blocking Peptide, catalog no. 33R-9062, is also available for use as a blocking control in assays to test for specificity of this PPP2R3B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PPP2R3B

Antigène: PPP2R3B (Protein Phosphatase 2A 48 KDa Regulatory Subunit (PPP2R3B))

Autre désignation: PPP2R3B (PPP2R3B Produits)

Synonymes: anticorps NYREN8, anticorps PPP2R3L, anticorps PPP2R3LY, anticorps PR48, anticorps im:6895423, anticorps si:ch211-269e2.2, anticorps protein phosphatase 2 regulatory subunit B''beta, anticorps serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta, anticorps protein phosphatase 2, regulatory subunit B'', beta, anticorps protein phosphatase 2 regulatory subunit B', beta L homeolog, anticorps PPP2R3B, anticorps LOC607103, anticorps ppp2r3b, anticorps ppp2r3b.L, anticorps Ppp2r3b

Sujet: Protein phosphatase 2 (formerly named type 2A) is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2 holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B.

Poids moléculaire: 65 kDa (MW of target protein)

Pathways: Signalisation PI3K-Akt, Mitotic G1-G1/S Phases