SPO11 anticorps

N° du produit ABIN634167

Détail du produit anti-SPO11 anticorps

Antigène: SPO11 (SPO11 Meiotic Protein Covalently Bound To DSB Homolog (SPO11))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SPO11 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SPO11 antibody was raised using a synthetic peptide corresponding to a region with amino acids KFSLILKILSMIYKLVQSNTYATKRDIYYTDSQLFGNQTVVDNIINDISC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SPO11 Blocking Peptide, catalog no. 33R-4380, is also available for use as a blocking control in assays to test for specificity of this SPO11 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPO11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SPO11

Antigène: SPO11 (SPO11 Meiotic Protein Covalently Bound To DSB Homolog (SPO11))

Autre désignation: SPO11 (SPO11 Produits)

Synonymes: anticorps CT35, anticorps SPATA43, anticorps TOPVIA, anticorps zgc:77876, anticorps AI449549, anticorps Meiotic recombination protein spo-11, anticorps SPO11, initiator of meiotic double stranded breaks, anticorps SPO11 meiotic protein covalently bound to DSB, anticorps spo-11, anticorps SPO11, anticorps Spo11, anticorps spo11

Sujet: Meiotic recombination and chromosome segregation require the formation of double-strand breaks (DSBs) in paired chromosome homologs. During meiosis in yeast, a meiotic recombination protein is covalently-linked to the 5' end of DSBs and is essential for the formation of DSBs. SPO11 is similar in sequence and conserved features to the yeast meiotic recombination protein. It belongs to the TOP6A protein family.

Poids moléculaire: 44 kDa (MW of target protein)