MSH4 anticorps

N° du produit ABIN634190

Détail du produit anti-MSH4 anticorps

Antigène: MSH4 (MutS Homolog 4 (E. Coli) (MSH4))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MSH4 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: MSH4 antibody was raised using a synthetic peptide corresponding to a region with amino acids EITTQITRQILQNQRSTPEMERQRAVYHLATRLVQTARNSQLDPDSLRIY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MSH4 Blocking Peptide, catalog no. 33R-2488, is also available for use as a blocking control in assays to test for specificity of this MSH4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MSH4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MSH4

Antigène: MSH4 (MutS Homolog 4 (E. Coli) (MSH4))

Autre désignation: MSH4 (MSH4 Produits)

Synonymes: anticorps MSH4, anticorps 4930485C04Rik, anticorps AV144863, anticorps mMsh4, anticorps mutS homolog 4, anticorps mutS protein homolog 4, anticorps Msh4, anticorps MSH4, anticorps msh4, anticorps LOC575381, anticorps LOC100639599

Sujet: MSH4 is involved in meiotic recombination. MSH4 is required for reciprocal recombination and proper segregation of homologous chromosomes at meiosis.

Poids moléculaire: 105 kDa (MW of target protein)