CCT7 anticorps

N° du produit ABIN634207

Détail du produit anti-CCT7 anticorps

Antigène: CCT7 (Chaperonin Containing TCP1, Subunit 7 (Eta) (CCT7))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CCT7 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: CCT7 antibody was raised using a synthetic peptide corresponding to a region with amino acids RAIKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CCT7 Blocking Peptide, catalog no. 33R-7811, is also available for use as a blocking control in assays to test for specificity of this CCT7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCT7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CCT7

Antigène: CCT7 (Chaperonin Containing TCP1, Subunit 7 (Eta) (CCT7))

Autre désignation: CCT7 (CCT7 Produits)

Synonymes: anticorps Cct7, anticorps cct-eta, anticorps ccth, anticorps nip7-1, anticorps tcp-1-eta, anticorps CCTETA, anticorps CCTH, anticorps NIP7-1, anticorps TCP1ETA, anticorps CCT-ETA, anticorps TCP-1-ETA, anticorps AA408524, anticorps AL022769, anticorps Ccth, anticorps Cctz, anticorps chunp6934, anticorps fb38h02, anticorps fc05g05, anticorps wu:fb38h02, anticorps wu:fc05g05, anticorps chaperonin containing TCP1, subunit 7 (eta), anticorps chaperonin containing TCP1 subunit 7, anticorps chaperonin containing Tcp1, subunit 7 (eta), anticorps chaperonin containing TCP1 subunit 7 S homeolog, anticorps Cct7, anticorps cct7, anticorps CCT7, anticorps cct7.S

Sujet: CCT7 is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin.

Poids moléculaire: 60 kDa (MW of target protein)