RAD54B anticorps

N° du produit ABIN634225

Détail du produit anti-RAD54B anticorps

Antigène: RAD54B (DNA repair and recombination protein RAD54B (RAD54B))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RAD54B est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: RAD54 B antibody was raised using a synthetic peptide corresponding to a region with amino acids NSLKPLSMSQLKQWKHFSGDHLNLTDPFLERITENVSFIFQNITTQATGT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RAD54B Blocking Peptide, catalog no. 33R-6882, is also available for use as a blocking control in assays to test for specificity of this RAD54B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAD50 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RAD54B

Antigène: RAD54B (DNA repair and recombination protein RAD54B (RAD54B))

Autre désignation: RAD54B (RAD54B Produits)

Synonymes: anticorps RAD54B, anticorps im:7137737, anticorps im:7153525, anticorps fsbp, anticorps rdh54, anticorps RDH54, anticorps E130016E03Rik, anticorps Fsbp, anticorps RGD1306507, anticorps RAD54 homolog B (S. cerevisiae), anticorps RAD54 homolog B L homeolog, anticorps RAD54B, anticorps rad54b, anticorps rad54b.L, anticorps Rad54b

Sujet: RAD54B belongs to the DEAD-like helicase superfamily. It shares similarity with Saccharomyces cerevisiae RAD54 and RDH54, both of which are involved in homologous recombination and repair of DNA. This protein binds to double-stranded DNA, and displays ATPase activity in the presence of DNA. This gene is highly expressed in testis and spleen, which suggests active roles in meiotic and mitotic recombination. Homozygous mutations of this gene were observed in primary lymphoma and colon cancer.

Poids moléculaire: 103 kDa (MW of target protein)