PDGFB anticorps (N-Term)

N° du produit ABIN634264

Détail du produit anti-PDGFB anticorps

Antigène: PDGFB (Platelet Derived Growth Factor Subunit B (PDGFB))

Épitope: N-Term

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PDGFB est non-conjugé

Application: Western Blotting (WB)

Specificité: PDGFB antibody was raised against the N terminal of PDGFB

Purification: Affinity purified

Immunogène: PDGFB antibody was raised using the N terminal of PDGFB corresponding to a region with amino acids NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PDGFB Blocking Peptide, catalog no. 33R-6853, is also available for use as a blocking control in assays to test for specificity of this PDGFB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDGFB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PDGFB

Antigène: PDGFB (Platelet Derived Growth Factor Subunit B (PDGFB))

Autre désignation: PDGFB (PDGFB Produits)

Synonymes: anticorps PDGF-2, anticorps PDGF2, anticorps SIS, anticorps SSV, anticorps c-sis, anticorps pdgf2, anticorps sis, anticorps si:ch211-79m20.1, anticorps si:dkey-261d11.1, anticorps PDGF-B, anticorps Sis, anticorps platelet derived growth factor subunit B, anticorps platelet-derived growth factor beta polypeptide, anticorps platelet derived growth factor subunit B S homeolog, anticorps platelet-derived growth factor beta polypeptide a, anticorps platelet derived growth factor, B polypeptide, anticorps PDGFB, anticorps pdgfb.S, anticorps pdgfba, anticorps Pdgfb

Sujet: PDGFB is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a motif of eight cysteines. PDGFB can exist either as a homodimer (PDGF-BB) or as a heterodimer with the platelet-derived growth factor alpha polypeptide (PDGF-AB), where the dimers are connected by disulfide bonds. Mutations in this gene are associated with meningioma. Reciprocal translocations between chromosomes 22 and 7, at sites where this gene and that for COL1A1 are located, are associated with a particular type of skin tumor called dermatofibrosarcoma protuberans resulting from unregulated expression of growth factor.

Poids moléculaire: 27 kDa (MW of target protein)

Pathways: Signalisation RTK, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Regulation of Carbohydrate Metabolic Process, Smooth Muscle Cell Migration, Platelet-derived growth Factor Receptor Signaling