Inhibin alpha anticorps (N-Term)

N° du produit ABIN634265

Détail du produit anti-Inhibin alpha anticorps

Antigène: Inhibin alpha (INHA) (Inhibin, alpha (INHA))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Inhibin alpha est non-conjugé

Application: Western Blotting (WB)

Specificité: Inhibin Alpha antibody was raised against the N terminal of INHA

Purification: Affinity purified

Immunogène: Inhibin Alpha antibody was raised using the N terminal of INHA corresponding to a region with amino acids GLAQEAEEGLFRYMFRPSQHTRSRQVTSAQLWFHTGLDRQGTAASNSSEP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Inhibin Alpha Blocking Peptide, catalog no. 33R-3384, is also available for use as a blocking control in assays to test for specificity of this Inhibin Alpha antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of INHA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Inhibin alpha

Antigène: Inhibin alpha (INHA) (Inhibin, alpha (INHA))

Autre désignation: Inhibin alpha (INHA Produits)

Synonymes: anticorps si:dkey-91f15.2, anticorps INHA, anticorps MGC108500, anticorps AW555078, anticorps inhibin, alpha, anticorps inhibin alpha subunit, anticorps inhibin alpha, anticorps inhibin alpha L homeolog, anticorps inha, anticorps INHA, anticorps inha.L, anticorps Inha

Sujet: INHA joins either the beta A or beta B subunit to form a pituitary FSH secretion inhibitor. Inhibin has been shown to regulate gonadal stromal cell proliferation negatively and to have tumour-suppressor activity. In addition, serum levels of inhibin have been shown to reflect the size of granulosa-cell tumors and can therefore be used as a marker for primary as well as recurrent disease. However, in prostate cancer, expression of the inhibin alpha-subunit gene was suppressed and was not detectable in poorly differentiated tumor cells. Furthermore, because expression in gonadal and various extragonadal tissues may vary severalfold in a tissue-specific fashion, it is proposed that inhibin may be both a growth/differentiation factor and a hormone.

Poids moléculaire: 40 kDa (MW of target protein)

Pathways: Peptide Hormone Metabolism, Hormone Activity, Negative Regulation of Hormone Secretion