IL-1 beta anticorps (N-Term)

N° du produit ABIN634267

Détail du produit anti-IL-1 beta anticorps

Antigène: IL-1 beta (IL1B) (Interleukin 1, beta (IL1B))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IL-1 beta est non-conjugé

Application: Western Blotting (WB)

Specificité: IL1 beta antibody was raised against the N terminal of IL1 B

Purification: Affinity purified

Immunogène: IL1 beta antibody was raised using the N terminal of IL1 B corresponding to a region with amino acids MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IL1 beta Blocking Peptide, catalog no. 33R-5648, is also available for use as a blocking control in assays to test for specificity of this IL1 beta antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IL-1 beta

Antigène: IL-1 beta (IL1B) (Interleukin 1, beta (IL1B))

Autre désignation: IL1 beta (IL1B Produits)

Synonymes: anticorps IL-1, anticorps IL1-BETA, anticorps IL1F2, anticorps IL-1BETA, anticorps IL1beta, anticorps il1-b, anticorps zgc:111873, anticorps IL-1B, anticorps IL-1beta, anticorps Il-1b, anticorps IL1B, anticorps IL-1 beta, anticorps IL-1b, anticorps interleukin 1 beta, anticorps interleukin 1, beta, anticorps IL1B, anticorps il1b, anticorps Il1b

Sujet: IL1B is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. The gene encoding IL1B and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2.

Poids moléculaire: 17 kDa (MW of target protein)

Pathways: Signalisation NF-kappaB, Interferon-gamma Pathway, Signalisation TLR, Negative Regulation of Hormone Secretion, Cellular Response to Molecule of Bacterial Origin, Carbohydrate Homeostasis, Glycosaminoglycan Metabolic Process, Myometrial Relaxation and Contraction, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Autophagy, Cancer Immune Checkpoints, Inflammasome