EGF anticorps
-
- Antigène Voir toutes EGF Anticorps
- EGF (Epidermal Growth Factor (EGF))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp EGF est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- EGF antibody was raised using a synthetic peptide corresponding to a region with amino acids ITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDY
- Top Product
- Discover our top product EGF Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
EGF Blocking Peptide, catalog no. 33R-4179, is also available for use as a blocking control in assays to test for specificity of this EGF antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EGF antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- EGF (Epidermal Growth Factor (EGF))
- Autre désignation
- EGF (EGF Produits)
- Synonymes
- anticorps HOMG4, anticorps URG, anticorps AI790464, anticorps CEGF, anticorps epidermal growth factor, anticorps pro-epidermal growth factor, anticorps EGF, anticorps egf, anticorps CpipJ_CPIJ020278, anticorps Egf
- Sujet
- Epidermal growth factor has a profound effect on the differentiation of specific cells in vivo and is a potent mitogenic factor for a variety of cultured cells of both ectodermal and mesodermal origin.
- Poids moléculaire
- 6 kDa (MW of target protein)
- Pathways
- Signalisation NF-kappaB, Signalisation RTK, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Regulation of Carbohydrate Metabolic Process, Hepatitis C, Protein targeting to Nucleus, Interaction of EGFR with phospholipase C-gamma, Thromboxane A2 Receptor Signaling, EGFR Downregulation
-