ABCF2 anticorps
-
- Antigène Voir toutes ABCF2 Anticorps
- ABCF2 (ATP-Binding Cassette, Sub-Family F (GCN20), Member 2 (ABCF2))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ABCF2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- ABCF2 antibody was raised using a synthetic peptide corresponding to a region with amino acids YGLTGKQQVSPIRNLSDGQKCRVCLAWLAWQNPHMLFLDEPTNHLDIETI
- Top Product
- Discover our top product ABCF2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ABCF2 Blocking Peptide, catalog no. 33R-10106, is also available for use as a blocking control in assays to test for specificity of this ABCF2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCF2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ABCF2 (ATP-Binding Cassette, Sub-Family F (GCN20), Member 2 (ABCF2))
- Autre désignation
- ABCF2 (ABCF2 Produits)
- Synonymes
- anticorps abcf2, anticorps fc74f03, anticorps fd58d07, anticorps wu:fb04f06, anticorps wu:fc74f03, anticorps wu:fd58d07, anticorps MGC53054, anticorps ABCF2, anticorps DDBDRAFT_0185833, anticorps DDBDRAFT_0191228, anticorps DDB_0185833, anticorps DDB_0191228, anticorps DKFZp468L0120, anticorps ABC28, anticorps EST133090, anticorps HUSSY18, anticorps 0710005O05Rik, anticorps Drr3, anticorps E430001O06, anticorps ABC transporter, class F, anticorps ATP-binding cassette, sub-family F (GCN20), member 2a, anticorps ATP binding cassette subfamily F member 2 L homeolog, anticorps ATP binding cassette subfamily F member 2, anticorps ATP-binding cassette sub-family F member 2, anticorps ABC transporter-related protein, anticorps ATP-binding cassette, sub-family F (GCN20), member 2, anticorps abcf-2, anticorps abcf2a, anticorps abcf2.L, anticorps ABCF2, anticorps LOC732866, anticorps ATEG_09303, anticorps LELG_02356, anticorps HCAG_02904, anticorps CpipJ_CPIJ002890, anticorps BDBG_04114, anticorps abcF2, anticorps PAAG_04904, anticorps abcf2, anticorps Abcf2
- Sujet
- The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This protein is a member of the GCN20 subfamily. Alternative splicing of this gene results in multiple transcript variants.
- Poids moléculaire
- 72 kDa (MW of target protein)
-