RFT1 anticorps

N° du produit ABIN634279

Détail du produit anti-RFT1 anticorps

Antigène: RFT1 (RFT1 Homolog (RFT1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RFT1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: RFT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GTQRDWSQTLNLLWLTVPLGVFWSLFLGWIWLQLLEVPDPNVVPHYATGV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RFT1 Blocking Peptide, catalog no. 33R-3615, is also available for use as a blocking control in assays to test for specificity of this RFT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RFT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RFT1

Antigène: RFT1 (RFT1 Homolog (RFT1))

Autre désignation: RFT1 (RFT1 Produits)

Synonymes: anticorps GB14370, anticorps CDG1N, anticorps D930025H04, anticorps RGD1562654, anticorps protein RFT1 homolog, anticorps RFT1 homolog, anticorps LOC412489, anticorps LOC100453537, anticorps RFT1, anticorps rft1, anticorps LOC100633251, anticorps LOC100651701, anticorps Rft1

Sujet: N-glycosylation of proteins follows a highly conserved pathway that begins with the synthesis of aMan(5)GlcNAc(2)-dolichylpyrophosphate (PP-Dol) intermediate on the cytoplasmic side of the endoplasmic reticulum (ER) membrane followed by the translocation of Man(5)GlcNAc (2)-PP-Dol to the luminal side of the ER membrane. RFT1 is the flippase enzyme that catalyzes this translocation.

Poids moléculaire: 60 kDa (MW of target protein)