ACPP anticorps (Middle Region)

N° du produit ABIN634280

L’anticorps anti-ACPP Polyclonal Lapin est utilisé pour la détection de ACPP dans des échantillons de Humain, Souris et Rat. Il a été validé pour WB.

Aperçu rapide pour ACPP anticorps (Middle Region) (ABIN634280)

Antigène: ACPP (Acid Phosphatase, Prostate (ACPP))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACPP est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ACPP anticorps

Épitope: Middle Region

Specificité: ACPP antibody was raised against the middle region of ACPP

Purification: Affinity purified

Immunogène: ACPP antibody was raised using the middle region of ACPP corresponding to a region with amino acids CESVHNFTLPSWATEDTMTKLRELSELSLLSLYGIHKQKEKSRLQGGVLV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACPP Blocking Peptide, (ABIN937065), is also available for use as a blocking control in assays to test for specificity of this ACPP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACPP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACPP

Antigène: ACPP (Acid Phosphatase, Prostate (ACPP))

Autre désignation: ACPP

Sujet: This gene encodes an enzyme that catalyzes the conversion of orthophosphoric monoester to alcohol and orthophosphate. It is synthesized under androgen regulation and is secreted by the epithelial cells of the prostate gland.

Poids moléculaire: 41 kDa (MW of target protein)

Pathways: Synaptic Membrane, Ribonucleoside Biosynthetic Process