ACPP anticorps (Middle Region)

N° du produit ABIN634280

Détail du produit anti-ACPP anticorps

Antigène: ACPP (Acid Phosphatase, Prostate (ACPP))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACPP est non-conjugé

Application: Western Blotting (WB)

Specificité: ACPP antibody was raised against the middle region of ACPP

Purification: Affinity purified

Immunogène: ACPP antibody was raised using the middle region of ACPP corresponding to a region with amino acids CESVHNFTLPSWATEDTMTKLRELSELSLLSLYGIHKQKEKSRLQGGVLV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACPP Blocking Peptide, catalog no. 33R-1679, is also available for use as a blocking control in assays to test for specificity of this ACPP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACPP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACPP

Antigène: ACPP (Acid Phosphatase, Prostate (ACPP))

Autre désignation: ACPP (ACPP Produits)

Synonymes: anticorps 5'-NT, anticorps ACP-3, anticorps ACP3, anticorps PAP, anticorps AMAP2, anticorps CENTB3, anticorps DDEF2, anticorps PAG3, anticorps Pap-alpha, anticorps SHAG1, anticorps A030005E02Rik, anticorps FRAP, anticorps Lap, anticorps Ppal, anticorps Acpp11, anticorps RNACPP11, anticorps pap, anticorps ACPP, anticorps acp-3, anticorps acp3, anticorps acpt, anticorps acid phosphatase, prostate, anticorps ArfGAP with SH3 domain, ankyrin repeat and PH domain 2, anticorps prostatic acid phosphatase, anticorps prostatic acid phosphatase, putative, anticorps acid phosphatase, prostate S homeolog, anticorps ACPP, anticorps ASAP2, anticorps Acpp, anticorps CpipJ_CPIJ004002, anticorps Smp_016640, anticorps acpp.S

Sujet: This gene encodes an enzyme that catalyzes the conversion of orthophosphoric monoester to alcohol and orthophosphate. It is synthesized under androgen regulation and is secreted by the epithelial cells of the prostate gland.

Poids moléculaire: 41 kDa (MW of target protein)

Pathways: Synaptic Membrane, Ribonucleoside Biosynthetic Process