GRK5 anticorps (Middle Region)

N° du produit ABIN634307

Détail du produit anti-GRK5 anticorps

Antigène: GRK5 (G Protein-Coupled Receptor Kinase 5 (GRK5))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GRK5 est non-conjugé

Application: Western Blotting (WB)

Specificité: GRK5 antibody was raised against the middle region of GRK5

Purification: Affinity purified

Immunogène: GRK5 antibody was raised using the middle region of GRK5 corresponding to a region with amino acids FYAAEILCGLEDLHRENTVYRDLKPENILLDDYGHIRISDLGLAVKIPEG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GRK5 Blocking Peptide, catalog no. 33R-3133, is also available for use as a blocking control in assays to test for specificity of this GRK5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRK5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GRK5

Antigène: GRK5 (G Protein-Coupled Receptor Kinase 5 (GRK5))

Autre désignation: GRK5 (GRK5 Produits)

Synonymes: anticorps GPRK5, anticorps Gprk5, anticorps si:dkey-171l20.1, anticorps GRK5, anticorps DKFZp468J1119, anticorps grk5, anticorps G protein-coupled receptor kinase 5, anticorps G protein-coupled receptor kinase 5 L homeolog, anticorps GRK5, anticorps Grk5, anticorps grk5, anticorps grk5.L

Sujet: GRK5 is a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. It has also been shown to play a role in regulating the motility of polymorphonuclear leukocytes (PMNs).

Poids moléculaire: 68 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling