Peroxiredoxin 5 anticorps (Middle Region)

N° du produit ABIN634328

Détail du produit anti-Peroxiredoxin 5 anticorps

Antigène: Peroxiredoxin 5 (PRDX5)

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Peroxiredoxin 5 est non-conjugé

Application: Western Blotting (WB)

Specificité: PRDX5 antibody was raised against the middle region of PRDX5

Purification: Affinity purified

Immunogène: PRDX5 antibody was raised using the middle region of PRDX5 corresponding to a region with amino acids TDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRDX5 Blocking Peptide, catalog no. 33R-9012, is also available for use as a blocking control in assays to test for specificity of this PRDX5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRDX5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Peroxiredoxin 5

Antigène: Peroxiredoxin 5 (PRDX5)

Autre désignation: PRDX5 (PRDX5 Produits)

Synonymes: anticorps acr1, anticorps aoeb166, anticorps pmp20, anticorps prx-5, anticorps prx5, anticorps prxv, anticorps sbbi10, anticorps GB16965, anticorps zgc:112318, anticorps PRDX5, anticorps CG 32920, anticorps CG 7217, anticorps CG32920, anticorps CG7217, anticorps Dmel\\CG7217, anticorps dPrx5, anticorps dprx5, anticorps ACR1, anticorps AOEB166, anticorps B166, anticorps PLP, anticorps PMP20, anticorps PRDX6, anticorps PRXV, anticorps prx-V, anticorps AOPP, anticorps Pmp20, anticorps Prdx6, anticorps PrxV, anticorps Aoeb166, anticorps Prx V, anticorps peroxiredoxin 5 L homeolog, anticorps peroxiredoxin-5, mitochondrial, anticorps peroxiredoxin 5, anticorps Peroxiredoxin 5, anticorps prdx5.L, anticorps LOC552429, anticorps prdx5, anticorps PRDX5, anticorps Prx5, anticorps Prdx5

Sujet: PRDX5 is a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in different tissues under normal conditions and during inflammatory processes. This protein interacts with peroxisome receptor 1. The crystal structure of this protein in its reduced form has been resolved to 1.5 angstrom resolution. This gene uses alternate in-frame translation initiation sites to generate mitochondrial or peroxisomal/cytoplasmic forms.

Poids moléculaire: 14 kDa (MW of target protein)

Pathways: Cell RedoxHomeostasis