GNA15 anticorps (N-Term)
-
- Antigène Voir toutes GNA15 Anticorps
- GNA15 (Guanine Nucleotide Binding Protein (G Protein), alpha 15 (Gq Class) (GNA15))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GNA15 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GNA15 antibody was raised against the N terminal of GNA15
- Purification
- Affinity purified
- Immunogène
- GNA15 antibody was raised using the N terminal of GNA15 corresponding to a region with amino acids ARSLTWRCCPWCLTEDEKAAARVDQEINRILLEQKKQDRGELKLLLLGPG
- Top Product
- Discover our top product GNA15 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GNA15 Blocking Peptide, catalog no. 33R-1493, is also available for use as a blocking control in assays to test for specificity of this GNA15 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNA15 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GNA15 (Guanine Nucleotide Binding Protein (G Protein), alpha 15 (Gq Class) (GNA15))
- Autre désignation
- GNA15 (GNA15 Produits)
- Synonymes
- anticorps GNA16, anticorps G[a]15, anticorps Galpha15, anticorps G protein subunit alpha 15, anticorps guanine nucleotide binding protein (G protein), alpha 15 (Gq class), anticorps guanine nucleotide binding protein, alpha 15, anticorps GNA15, anticorps Gna15
- Sujet
- GNA15 belongs to the G-alpha family. Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.
- Poids moléculaire
- 41 kDa (MW of target protein)
-