SAMHD1 anticorps (Middle Region)

N° du produit ABIN634417

Détail du produit anti-SAMHD1 anticorps

Antigène: SAMHD1 (SAM Domain and HD Domain 1 (SAMHD1))

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SAMHD1 est non-conjugé

Application: Western Blotting (WB)

Specificité: SAMHD1 antibody was raised against the middle region of SAMHD1

Purification: Affinity purified

Immunogène: SAMHD1 antibody was raised using the middle region of SAMHD1 corresponding to a region with amino acids KGRPENKSFLYEIVSNKRNGIDVDKWDYFARDCHHLGIQNNFDYKRFIKF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SAMHD1 Blocking Peptide, catalog no. 33R-4405, is also available for use as a blocking control in assays to test for specificity of this SAMHD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAMHD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SAMHD1

Antigène: SAMHD1 (SAM Domain and HD Domain 1 (SAMHD1))

Autre désignation: SAMHD1 (SAMHD1 Produits)

Synonymes: anticorps CHBL2, anticorps DCIP, anticorps HDDC1, anticorps MOP-5, anticorps SBBI88, anticorps si:dkeyp-44b8.8, anticorps E330031J07Rik, anticorps Mg11, anticorps SAM and HD domain containing deoxynucleoside triphosphate triphosphohydrolase 1, anticorps SAM domain and HD domain 1, anticorps SAM domain and HD domain, 1, anticorps SAMHD1, anticorps samhd1, anticorps Samhd1

Sujet: SAMHD1 contains 1 HD domain and 1 SAM (sterile alpha motif) domain. SAMHD1 may play a role in mediating proinflammatory responses to TNF-alpha signaling.

Poids moléculaire: 72 kDa (MW of target protein)