NKIRAS2 anticorps (Middle Region)

N° du produit ABIN634432

Détail du produit anti-NKIRAS2 anticorps

Antigène: NKIRAS2 (NFKB Inhibitor Interacting Ras-Like 2 (NKIRAS2))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NKIRAS2 est non-conjugé

Application: Western Blotting (WB)

Specificité: NKIRAS2 antibody was raised against the middle region of NKIRAS2

Purification: Affinity purified

Immunogène: NKIRAS2 antibody was raised using the middle region of NKIRAS2 corresponding to a region with amino acids KKEVTIVVLGNKCDLQEQRRVDPDVAQHWAKSEKVKLWEVSVADRRSLLE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NKIRAS2 Blocking Peptide, catalog no. 33R-4460, is also available for use as a blocking control in assays to test for specificity of this NKIRAS2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NKIRAS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NKIRAS2

Antigène: NKIRAS2 (NFKB Inhibitor Interacting Ras-Like 2 (NKIRAS2))

Autre désignation: NKIRAS2 (NKIRAS2 Produits)

Synonymes: anticorps NKIRAS2, anticorps KBRAS2, anticorps kappaB-Ras2, anticorps zgc:92870, anticorps 2410003M04Rik, anticorps 4930527H08Rik, anticorps D630018G21Rik, anticorps NFKB inhibitor interacting Ras like 2, anticorps NFKB inhibitor interacting Ras-like 2, anticorps NFKB inhibitor interacting Ras like 2 L homeolog, anticorps NFKB inhibitor interacting Ras-like protein 2, anticorps NKIRAS2, anticorps Nkiras2, anticorps nkiras2, anticorps nkiras2.L

Sujet: NPAL2 is a multi-pass membrane protein and it belongs to the NIPA family. The exact function of NPAL2 remains unknown.

Poids moléculaire: 21 kDa (MW of target protein)