PSMB10 anticorps
-
- Antigène Voir toutes PSMB10 Anticorps
- PSMB10 (Proteasome (Prosome, Macropain) Subunit, beta Type 10 (PSMB10))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PSMB10 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- PSMB10 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQG
- Top Product
- Discover our top product PSMB10 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PSMB10 Blocking Peptide, catalog no. 33R-2068, is also available for use as a blocking control in assays to test for specificity of this PSMB10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMB10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PSMB10 (Proteasome (Prosome, Macropain) Subunit, beta Type 10 (PSMB10))
- Autre désignation
- PSMB10 (PSMB10 Produits)
- Synonymes
- anticorps Mecl-1, anticorps Mecl1, anticorps LMP10, anticorps MECL1, anticorps beta2i, anticorps proteasome (prosome, macropain) subunit, beta type 10, anticorps proteasome subunit beta 10, anticorps Psmb10, anticorps PSMB10
- Sujet
- The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure.
- Poids moléculaire
- 25 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA
-