LBP anticorps (Middle Region)
-
- Antigène Voir toutes LBP Anticorps
- LBP (Lipopolysaccharide Binding Protein (LBP))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LBP est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- LBP antibody was raised against the middle region of LBP
- Purification
- Affinity purified
- Immunogène
- LBP antibody was raised using the middle region of LBP corresponding to a region with amino acids LLGSESSGRPTVTASSCSSDIADVEVDMSGDLGWLLNLFHNQIESKFQKV
- Top Product
- Discover our top product LBP Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LBP Blocking Peptide, catalog no. 33R-5143, is also available for use as a blocking control in assays to test for specificity of this LBP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LBP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- LBP (Lipopolysaccharide Binding Protein (LBP))
- Autre désignation
- LBP (LBP Produits)
- Synonymes
- anticorps BPIFD2, anticorps Bpifd2, anticorps Ly88, anticorps LPSBP, anticorps LBP, anticorps lipopolysaccharide binding protein, anticorps lipopolysaccharide-binding protein, anticorps LBP, anticorps Lbp, anticorps LOC100472839
- Sujet
- LBP is involved in the acute-phase immunologic response to gram-negative bacterial infections. Gram-negative bacteria contain a glycolipid, lipopolysaccharide (LPS), on their outer cell wall. Together with bactericidal permeability-increasing protein (BPI), the protein binds LPS and interacts with the CD14 receptor, probably playing a role in regulating LPS-dependent monocyte responses.
- Poids moléculaire
- 51 kDa (MW of target protein)
- Pathways
- Signalisation TLR, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Positive Regulation of Immune Effector Process, Toll-Like Receptors Cascades, Monocarboxylic Acid Catabolic Process
-