Lipocalin 1 anticorps

N° du produit ABIN634487

L’anticorps anti-Lipocalin 1 Polyclonal Lapin est utilisé pour la détection de Lipocalin 1 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour Lipocalin 1 anticorps (ABIN634487)

Antigène: Lipocalin 1 (LCN1)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Lipocalin 1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Lipocalin 1 anticorps

Purification: Affinity purified

Immunogène: Lipocalin 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids IRSHVKDHYIFYCEGELHGKPVRGVKLVGRDPKNNLEALEDFEKAAGARG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Lipocalin 1 Blocking Peptide, (ABIN939526), is also available for use as a blocking control in assays to test for specificity of this Lipocalin 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LCN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Lipocalin 1

Antigène: Lipocalin 1 (LCN1)

Autre désignation: Lipocalin 1

Sujet: LCN1 could play a role in taste reception. LCN1 could be necessary for the concentration and delivery of sapid molecules in the gustatory system. LCN1 can bind various ligands, with chemical structures ranging from lipids and retinoids to the macrocyclic antibiotic rifampicin and even to microbial siderophores. LCN1 exhibits an extremely wide ligand pocket.

Poids moléculaire: 17 kDa (MW of target protein)