Lipocalin 1 anticorps

N° du produit ABIN634487

Détail du produit anti-Lipocalin 1 anticorps

Antigène: Lipocalin 1 (LCN1)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Lipocalin 1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: Lipocalin 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids IRSHVKDHYIFYCEGELHGKPVRGVKLVGRDPKNNLEALEDFEKAAGARG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Lipocalin 1 Blocking Peptide, catalog no. 33R-4140, is also available for use as a blocking control in assays to test for specificity of this Lipocalin 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LCN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Lipocalin 1

Antigène: Lipocalin 1 (LCN1)

Autre désignation: Lipocalin 1 (LCN1 Produits)

Synonymes: anticorps PMFA, anticorps TLC, anticorps TP, anticorps VEGP, anticorps VEG, anticorps lipocalin 1, anticorps odorant binding protein 2B, anticorps lipocalin-1, anticorps LCN1, anticorps OBP2B, anticorps Lcn1, anticorps LOC103346758

Sujet: LCN1 could play a role in taste reception. LCN1 could be necessary for the concentration and delivery of sapid molecules in the gustatory system. LCN1 can bind various ligands, with chemical structures ranging from lipids and retinoids to the macrocyclic antibiotic rifampicin and even to microbial siderophores. LCN1 exhibits an extremely wide ligand pocket.

Poids moléculaire: 17 kDa (MW of target protein)